PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P04640_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 357aa    MW: 40352 Da    PI: 6.4584
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P04640_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-092843172255
                            SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +yps++e+  LA+++gL+++q+ +WF N+R ++
  GSMUA_Achr6P04640_001 284 WPYPSEAEKVALAESTGLDQKQINNWFINQRKRH 317
                            69*****************************885 PP

2ELK28.14.6e-10237255119
                    ELK   1 ELKhqLlrKYsgyLgsLkq 19 
                            ELKh+Ll+KY+ yL+sL+q
  GSMUA_Achr6P04640_001 237 ELKHHLLKKYGNYLSSLRQ 255
                            9*****************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.7E-2092136IPR005540KNOX1
PfamPF037906.1E-2194134IPR005540KNOX1
SMARTSM012562.4E-25140191IPR005541KNOX2
PfamPF037919.4E-23147190IPR005541KNOX2
PROSITE profilePS5121310.476237257IPR005539ELK domain
PfamPF037892.3E-6237255IPR005539ELK domain
SMARTSM011883.5E-5237258IPR005539ELK domain
PROSITE profilePS5007112.94257320IPR001356Homeobox domain
SuperFamilySSF466896.42E-19259333IPR009057Homeodomain-like
SMARTSM003895.7E-13259324IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-26262323IPR009057Homeodomain-like
CDDcd000865.30E-12269321No hitNo description
PfamPF059209.1E-17277316IPR008422Homeobox KN domain
PROSITE patternPS000270295318IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEELPHLGDG SSSAGSSRGA FLYLPSSAVA TTTTSAPPPP RSAVYEQSYY YYPTSHPYFH  60
TPPPKTEAGS SQFQTSRVET LSQGVISQSD IEEIKARIMS HPRYSTLLGA FVDCQKVGAP  120
PEVVERLSAI THELASRPRF HSGSYPDPEL DQFMESYCEM LIKYREELTR PLQEATDFLK  180
KMESQFNALT NTSTRGIFSS DEKCGGGGVD SSTEEEQDAS GGEAELREID PHAEDKELKH  240
HLLKKYGNYL SSLRQQLSKK KKKEKLPKDA RQKLLHWWEL HYTWPYPSEA EKVALAESTG  300
LDQKQINNWF INQRKRHWKP SADMQFALMD GFHPQNAAAA LYTQWQSMGD GTYHLHP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009403402.10.0PREDICTED: homeotic protein knotted-1-like
SwissprotQ413301e-119KN1_SOLLC; Homeotic protein knotted-1
TrEMBLM0T4620.0M0T462_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P04640_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98863145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-101KNOTTED-like from Arabidopsis thaliana